PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00408g00321.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 283aa    MW: 32107.4 Da    PI: 8.2109
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00408g00321.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.9e-332377155
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Peaxi162Scf00408g00321.1 23 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 77
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.4552080IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-322078IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-242378IPR006447Myb domain, plants
SuperFamilySSF466893.05E-162380IPR009057Homeodomain-like
PfamPF002498.5E-92576IPR001005SANT/Myb domain
PfamPF143792.3E-23127173IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MDRMISMYNG GYENGVVMTR DPKPRLRWTA DLHDRFVDAV TKLGGPDKAT PKSVLRLMGL  60
KGLTLYHLKS HLQKYRLGQQ TKKQNAAEQN RDNIGEFCMI LNTHSIFIKS NHYLLAKRSL  120
YLNREVSISE ALSSQFEVQK RLHEQLEVQQ KLQMRIEAQG KYLQAILDKA QKSLSTDMNS  180
PSAVEATRTQ LTDFNLALSN LMDCVHGDNR DETVAGRGTQ DDSNRQIPSS TYLSEEEQKK  240
NMNIKLEEDS ISFDLNSISG YDFIGMNAAA LEAKPLSNGR FEI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015083594.11e-149PREDICTED: myb family transcription factor APL isoform X2
SwissprotQ9SAK52e-52APL_ARATH; Myb family transcription factor APL
TrEMBLK4CMW81e-146K4CMW8_SOLLC; Uncharacterized protein
STRINGSolyc08g076010.2.11e-146(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44162139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.18e-77G2-like family protein